PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_E1D759A90.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Nin-like
Protein Properties Length: 750aa    MW: 82129.6 Da    PI: 6.1101
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_E1D759A90.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.24e-29400451152
                 RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                            aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Traes_3DS_E1D759A90.1 400 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 451
                            589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.643390471IPR003035RWP-RK domain
PfamPF020422.5E-26403451IPR003035RWP-RK domain
SuperFamilySSF542773.6E-22647740No hitNo description
PfamPF005644.3E-15656737IPR000270PB1 domain
PROSITE profilePS5174519.189656738IPR000270PB1 domain
SMARTSM006662.2E-24656738IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.8E-26656737No hitNo description
CDDcd064075.27E-34657737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MMYMFSVDGD NAGELGLPGR VYKQKVPEWT PNVQYYSSTE YPRLNHAISY NVHGTVALPV  60
FDPSVQSCIA VVELIMTSKK INYADEVDKV CKALEAVNLK STEILEHPNV QICNEGRQSA  120
LVEILEILTV VCEEHKLPLA QTWVPCKYRS VLAHGGGVKK SCLSFDGSCM GEVCMSTSDV  180
AFHVIDAHMW GFRDACVEHH LQKGQGVSGK AFIYHRPCFS KDISQFCKLE YPLVHYARMF  240
GLAGCFAICL QSPYTGDDYY MLEFFLPPSC KEEDDQNALL ESILGLINQC LRNLKVAGNG  300
ESNEASLQLS NVIMIESEDF KTNVHFENSE GFRESPEGDT HGGAHEFDKA NSKVSEGHLL  360
ADDNSQNNGV SVSRPNGSAA SDSSLLHKNG KPPERRRGKA EKTISLEVLQ QYFSGSLKNA  420
AKSLGVCPTT MKRICRQHGI SRWPSRKINK VNRSLSKLKQ VIESVQGSDA AFNLTSITGP  480
LPTIPVGPSS DSFNKEKASE SKAEHSNRAV DGDRDSSLQK SQENGSHFGA LMSQQGFADT  540
GNNVQLEADK ASLSRSSSGE GSINSRTSEG SCQGSPANQT FVCQPIASMF LEPQEPQLNP  600
EGFTKEPFQE PELPLSRMLI EDSGSSKDLK NLFGSAIGQP MLAPPSNFGP MRNSGTVTIK  660
ASFKEDIVRF RFPCSSSVMA LKDEVAKRLR MDAGMFDIKY LDDDHEWVKL ACNADLEECI  720
EISRHSGTHV IRLLVSDVAA HIGSSCGSSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLW5DKA10.0W5DKA1_WHEAT; Uncharacterized protein
STRINGBRADI2G08177.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]